Description
FOXO4-DRI Peptide Vial 10mg Isle of Man
In studies, FOXO4-DRI peptide Isle of Man restored the function of the liver and body weight to normal. FOX04-DRI also provides more hair, more movement, a better kidney function to fight senescence and ageing symptoms in quick-ageing (Xpd) mice.
FOXO4-DRI has been seen in research to prevent normal p53 binding of FOXO4, allowing for the removal of senescent cells, enhanced organ function, and “biological age” younger tissue.
FOX04-DRI influences the signals of insulin, control of the cell cycle and oxidative pathways of stress reporting.
FOXO4-DRI is a cell-penetrating peptide that has shown a selective reversal of the effects of ageing in animal study induced apoptosis of senescent cells.
Benefits of FOXO4-DRI 10mg Peptide VialIsle of Man :
- As demonstrated by clinical studies, treatment with FOX04 DRI appears to be beneficial in delaying the appearance of aged cells in animal models.
- According to research, female and male pattern baldness in mice may be helped by the FOXO4 DRI hormone. In addition, Isle of Man scientists know from a study that decreasing the generation of senescent cells enhances hair thickness and density, even if the administration of FOXO4 outside of research is still illegal.
- As animal studies have indicated, FOXO4-DRI can be utilised to enhance the heart’s fundamental functions and prevent age-related alterations in cardiovascular roles.
- It has been shown that the FOXO4 DRI protein is altered in the brain, leading scientists to suspect that FOXO may be useful in treating and preventing degenerative neurological illnesses. Researchers believe that this peptide may be able to halt the onset of neurodegenerative diseases such as dementia and Alzheimer’s disease.
Amino Acid Sequence:Â H-LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG-OH
Molecular Formula:Â C228H388N86O64
References:
https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7053614/
https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8116695/
DISCLAIMER:We do not supply Peptides or Sarms to any individual under the age of 21. You must be a licensed and qualified healthcare practitioner. All products listed on this website (https://iom.pharmagrade.store) and provided through Pharma Grade are intended ONLY FOR medical research purposes. Pharma Grade Isle of Man does not encourage or promote the use of any of these products in a personal capacity (i.e. human consumption) nor are the products intended as a drug, stimulant or for use in any food products.